General Information

  • ID:  hor005702
  • Uniprot ID:  P21779
  • Protein name:  Somatostatin-14
  • Gene name:  sst
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGCKNFFWKTFSSC
  • Length:  14(24-37)
  • Propeptide:  ALRAAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 85 seconds ( PubMed ID: 6117506 )

Structure

  • Disulfide bond:  45730
  • Structure ID:  AF-P21779-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005702_AF2.pdbhor005702_ESM.pdb

Physical Information

Mass: 185793 Formula: C75H104N18O19S2
Absent amino acids: DEHILMPQRVY Common amino acids: F
pI: 8.82 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: 2.14 Boman Index: -1053
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 7.14
Instability Index: 4440.71 Extinction Coefficient cystines: 5625
Absorbance 280nm: 432.69

Literature

  • PubMed ID:  2902094##6117506
  • Title:  Isolation and Characterization of a Variant somatostatin-14 and Two Related Somatostatins of 34 and 37 Residues From Lamprey (Petromyzon Marinus)